PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG032624.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YC
Protein Properties Length: 292aa    MW: 31469.2 Da    PI: 4.5084
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG032624.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC37.84e-121693098
        NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                 ++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t++   ++ +v++ ++fdfl +iv +
  CCG032624.1  1 MQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTMNSLHLKHCVQSYNVFDFLREIVSK 69
                 899**************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008083.0E-12154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471132.43E-19171IPR009072Histone-fold
Gene3DG3DSA:1.10.20.106.0E-18168IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MQADEDVGKI ALAVPVLVSK ALELFLQDLC DRTYEITLQR GAKTMNSLHL KHCVQSYNVF  60
DFLREIVSKV PDYSHGHSDA AADHRPLQKR KPTVDECNDS DEELKRSRMH ETSHAGSSGR  120
GRGRGRGRGR GRGARNIERE TSSRDLEPES STAVSLSVKN NSNPDVVMDN GSESKESVKE  180
NNIASDAASQ AERNFDLNAE VNDSEDAKAA AAAAATTTTA AAAAATTTTA AAAAAPTTAA  240
PSLSAEPAAE TNHEEYPGWS LSEMDKMAID PLQLAQFSTR DEEEEDYDEE EG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A8e-151552175Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121131RGRGRGRGRGR
2123132RGRGRGRGRG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011034688.10.0PREDICTED: dr1-associated corepressor homolog
TrEMBLB9GLW11e-152B9GLW1_POPTR; Uncharacterized protein
STRINGPOPTR_0001s07050.11e-151(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.12e-58nuclear factor Y, subunit C11